Mathematics, 10.05.2021 23:50 eddy3625

Find the volume of the following square pyramid.
26 cm
20 cm
20 cm
V = [?] cm3
Enter

Find the volume of the following

square pyramid.
26 cm
20 cm
20 cm
V = [?] cm3
Enter

Answers: 2

Show answers

Another question on Mathematics

Mathematics, 21.06.2019 18:00

Write an equation in slope intercept form of the line passes through the given point and is parallel to the graph of the given equation (0,0); y=3/8 x+2

Answers: 1

Answer

Mathematics, 21.06.2019 18:40

Christina can paint 420 square feet in 105 minutes. which unit rate describes the scenario?

Answers: 1

Answer

Mathematics, 21.06.2019 19:00

45 was divided by a power of ten to get 4.5. what power of ten was it divided by? people 4.5

Answers: 3

Answer

Mathematics, 21.06.2019 19:30

Which graph represents the equation y =4x

Answers: 1

Answer

You know the right answer?

Find the volume of the following square pyramid.
26 cm
20 cm
20 cm
V = [?]...

Questions

Mathematics, 14.12.2019 07:31

What is 1/5 3/7 2/7 5/8 4/5 as greatest to least...

History, 14.12.2019 07:31

50 points // native american questionthe tribal would observe the war games to determine the youths’ preparedness for real battle situati...

Social Studies, 14.12.2019 07:31

Which of the following was one way islam influenced the songhai empire?...

History, 14.12.2019 07:31

50 points // native american question which of the following statements about native warriors is incorrect? select the best answer...

Social Studies, 14.12.2019 07:31

Iwill mark as the brainliest answerplz put in order

Mathematics, 14.12.2019 07:31

25 the sequence 5, 20, 35, 50….. shows the number of sit-ups margie did each week, starting with her first week of the new year. (a) what...

English, 14.12.2019 07:31

Choose one paragraph from the novel that uses a variety of clauses and phrases. identify and label at least three different kinds of clauses and phras...

Arts, 14.12.2019 07:31

Rate your favorite minecraft you tuberdantdmpewdiepielittlekellyminecraftpoofesuregrian

Health, 14.12.2019 07:31

Which of the following is an example of a processed food...

English, 14.12.2019 07:31

How did you do? were you able to determine the meanings of the words? use this method as you read anything-a book, a magazine, your schoolwork...

Mathematics, 14.12.2019 07:31

25 the graph represents the first three terms in an arithmetic sequence. a. find the explicit expression for this sequence b. find...

Mathematics, 14.12.2019 07:31

Find two consecutive positive integers such that the square of the smaller integer added to seven times the larger integer is equal to 85...

English, 14.12.2019 07:31

Hernandez, sylvester . "re: why does animal testing make me crazy? " animalrightsblog. animalforallblog. com, 29 sept. 2008. weba. it was...

Mathematics, 14.12.2019 07:31

The local business club has 240 members.its rules state that a two-thirds majority isneeded to amend the bylaws. a certainfaction ha...

Mathematics, 14.12.2019 07:31

If i have -2x and i have to divide it by itself do i divide by 2 or -2?...

Mathematics, 14.12.2019 07:31

The midpoint of mn is point p at (–4, 6). if point m is at (8, –2), what are the coordinates of point n?...

Chemistry, 14.12.2019 07:31

Describe the chemical reaction based on the chemical equation

Mathematics, 14.12.2019 07:31

The endpoints of rs are r(–5, 12) and s(4, –6). what are the coordinates of point t, which divides rs into a 4: 5 ratio?...

History, 14.12.2019 07:31

Im a complete paragragh explain how intrest in ancient text led to demands for church reform. at least three detauld ina well writyen paragraph about...

Computers and Technology, 14.12.2019 07:31

Which is an example of synchronous communication. text message e-mail voicemail telephone conversation...

More questions: Mathematics Another questions

Find the volume of the following square pyramid. 26 cm 20 cm 20 cm V = [?] cm3 Enter

Answers

Another question on Mathematics

Find the volume of the following square pyramid.
26 cm
20 cm
20 cm
V = [?] cm3
Enter