subject
Mathematics, 12.11.2019 02:31 wegannet5

Find the height of an isosceles triangle having a base of 18m and the angle opposite the base measures 74.

ansver
Answers: 1
Show answers

Another question on Mathematics

question
Mathematics, 21.06.2019 20:20
The surface area of the triangular prism is .
Answers: 1
Answer
question
Mathematics, 21.06.2019 22:10
Ellen makes and sells bookmarks. she graphs the number of bookmarks sold compared to the total money earned. why is the rate of change for the function graphed to the left?
Answers: 1
Answer
question
Mathematics, 22.06.2019 02:00
The image of abc after a reflection across eg is abc
Answers: 2
Answer
question
Mathematics, 22.06.2019 02:00
If you were constructing a triangular frame, and you had wood in the length of 4inches, 4 inches, and 7 inches, would it make a triangle? would you be able to create a frame from these pieces of wood?
Answers: 1
Answer
You know the right answer?
Find the height of an isosceles triangle having a base of 18m and the angle opposite the base measur...
Questions
question
Mathematics, 14.12.2019 07:31
25 the sequence 5, 20, 35, 50….. shows the number of sit-ups margie did each week, starting with her first week of the new year. (a) what...
question
English, 14.12.2019 07:31
Choose one paragraph from the novel that uses a variety of clauses and phrases. identify and label at least three different kinds of clauses and phras...
question
Arts, 14.12.2019 07:31
Rate your favorite minecraft you tuberdantdmpewdiepielittlekellyminecraftpoofesuregrian
question
Health, 14.12.2019 07:31
Which of the following is an example of a processed food...
question
English, 14.12.2019 07:31
How did you do? were you able to determine the meanings of the words? use this method as you read anything-a book, a magazine, your schoolwork...
question
Mathematics, 14.12.2019 07:31
25 the graph represents the first three terms in an arithmetic sequence. a. find the explicit expression for this sequence b. find...
question
Mathematics, 14.12.2019 07:31
Find two consecutive positive integers such that the square of the smaller integer added to seven times the larger integer is equal to 85...
question
English, 14.12.2019 07:31
Hernandez, sylvester . "re: why does animal testing make me crazy? " animalrightsblog. animalforallblog. com, 29 sept. 2008. weba. it was...
question
Mathematics, 14.12.2019 07:31
The local business club has 240 members.its rules state that a two-thirds majority isneeded to amend the bylaws. a certainfaction ha...
question
Mathematics, 14.12.2019 07:31
If i have -2x and i have to divide it by itself do i divide by 2 or -2?...
question
Mathematics, 14.12.2019 07:31
The midpoint of mn is point p at (–4, 6). if point m is at (8, –2), what are the coordinates of point n?...
question
Chemistry, 14.12.2019 07:31
Describe the chemical reaction based on the chemical equation
question
Mathematics, 14.12.2019 07:31
The endpoints of rs are r(–5, 12) and s(4, –6). what are the coordinates of point t, which divides rs into a 4: 5 ratio?...
question
History, 14.12.2019 07:31
Im a complete paragragh explain how intrest in ancient text led to demands for church reform. at least three detauld ina well writyen paragraph about...
question
Computers and Technology, 14.12.2019 07:31
Which is an example of synchronous communication. text message e-mail voicemail telephone conversation...
question
English, 14.12.2019 07:31
Look at picture answer question which section of the article best explains the impacts of artificial trees on the christmas tree industry...
question
Mathematics, 14.12.2019 07:31
Jude says that the volume of a square pyramid with the base edges of 7 and height of 7 is equal to the volume of a cylinder with a radius of 7 and hei...
question
English, 14.12.2019 07:31
Why is it important to look at a larger societys needs instead of lookin at an individual's needs...
question
English, 14.12.2019 07:31
Why is it important to look at a larger societys needs instead of lookin at an individual's needs...
question
Mathematics, 14.12.2019 07:31
On a two-week job, a repairman works a total of 60 hours. he charges $80 plus $35 per hour. an equation shows this relationship, where x is the number...
More questions: Mathematics Another questions
Questions on the website: 13722367
See results (0)